DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and AT3G06470

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:268 Identity:63/268 - (23%)
Similarity:118/268 - (44%) Gaps:63/268 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IIITVYL--LFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWGIHLLFVQKPYNLSCM 88
            ::::|||  .|:|   |..:|...:|..| :||          .:..|..:.|..:.....:.|.
plant    38 VVVSVYLSATFLL---RSAIDSLPSLSPR-ILK----------PITAVHSLILCLLSLVMAVGCT 88

  Fly    89 QVLPQDHELKSTERTLSYM---------------------YHLNKVLDLMDTIFFVLRKKQRQIT 132
            ..:...|  .|::....::                     ::|:|:|:..|||..:|.|..::::
plant    89 LSITSSH--ASSDPMARFLHAICFPVDVKPNGPLFFWAQVFYLSKILEFGDTILIILGKSIQRLS 151

  Fly   133 FLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMF-NVLVHIVMYGYYYASSQSQNVQESLWWKKYL 196
            ||||:||..:|...::.:|   ....:|.|.:. |..||::|||||:..:.....:    ||:.:
plant   152 FLHVYHHATVVVMCYLWLR---TRQSMFPIALVTNSTVHVIMYGYYFLCAVGSRPK----WKRLV 209

  Fly   197 TLGQLVQFLLMF--------LHCMYTYFQPNCSASRGVIYVISSA-SAFMFLMFTKFYIKTYIRP 252
            |..|:|||:..|        .|    .|...|:...|  :..::| :|.:..:|:.|:.|.|:: 
plant   210 TDCQIVQFVFSFGLSGWMLREH----LFGSGCTGIWG--WCFNAAFNASLLALFSNFHSKNYVK- 267

  Fly   253 KEVKSKGK 260
            |..:..||
plant   268 KPTREDGK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 61/263 (23%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 60/258 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.