DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and AT3G06460

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:250 Identity:60/250 - (24%)
Similarity:115/250 - (46%) Gaps:50/250 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IIITVYL--LFVLK--------LGRKLMDKHEALQLRGVLKFYNIGQVLF-NSVIFVWGIHLLFV 79
            :::::||  .|:|:        ||.::        |:.:...:::  :|| .|:....|..|..:
plant    38 VVVSLYLSATFLLRYTVDSLPTLGPRI--------LKPITAVHSL--ILFLLSLTMAVGCTLSLI 92

  Fly    80 Q------KPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFH 138
            .      :.::..|   .|.|.:.|......:.:::|:|:|:.:||:..:|.|..::::||||:|
plant    93 SSSDPKARLFDAVC---FPLDVKPKGPLFFWAQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYH 154

  Fly   139 HVFMVFTSHMLIR----FYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLG 199
            |..:|...::.:|    .:..|      .:.|..||::|||||:..:.....:    |||.:|..
plant   155 HATVVILCYLWLRTRQSMFPVG------LVLNSTVHVIMYGYYFLCAIGSRPK----WKKLVTNF 209

  Fly   200 QLVQFLL-MFLHCMYT----YFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTY 249
            |:|||.. |.|...:.    ||...| |....:|.....:|.:..:|..|:.|.|
plant   210 QMVQFAFGMGLGAAWMLPEHYFGSGC-AGIWTVYFNGVFTASLLALFYNFHSKNY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 59/249 (24%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 59/249 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.830

Return to query results.
Submit another query.