DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and ELOVL7

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001098028.1 Gene:ELOVL7 / 79993 HGNCID:26292 Length:281 Species:Homo sapiens


Alignment Length:263 Identity:96/263 - (36%)
Similarity:138/263 - (52%) Gaps:28/263 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVI---FV---WGIH 75
            |..|.....|::..|:.||..||.|||:..:..:|:..:..||...|||:..:   ||   ||| 
Human    30 LMSSPLPQTILLGFYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYEFVMSGWGI- 93

  Fly    76 LLFVQKPYNLSCMQVLPQDHELKSTERTLS---YMYHLNKVLDLMDTIFFVLRKKQRQITFLHVF 137
                  .|:..|..|   |:....|...::   ::|:.:|.::|:||||||||||..|:||||||
Human    94 ------GYSFRCDIV---DYSRSPTALRMARTCWLYYFSKFIELLDTIFFVLRKKNSQVTFLHVF 149

  Fly   138 HHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLV 202
            ||..|.:|....::| ..||......:.|..||:|||.||..|:.....|:.||||||||..|||
Human   150 HHTIMPWTWWFGVKF-AAGGLGTFHALLNTAVHVVMYSYYGLSALGPAYQKYLWWKKYLTSLQLV 213

  Fly   203 QFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMF-LMFTKFYIKTYIR----PKEVKS---KG 259
            ||:::.:|....:|..:|.....|...|..:.:||| |:|..|:.:.|.:    ||.||:   |.
Human   214 QFVIVAIHISQFFFMEDCKYQFPVFACIIMSYSFMFLLLFLHFWYRAYTKGQRLPKTVKNGTCKN 278

  Fly   260 KVN 262
            |.|
Human   279 KDN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 92/253 (36%)
ELOVL7NP_001098028.1 ELO 30..269 CDD:307345 89/249 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.