DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and ELOVL6

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:266 Identity:67/266 - (25%)
Similarity:122/266 - (45%) Gaps:43/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDKPFADPVQLP-LAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSV 68
            |:|.|.:...:. :..:.:.|.:...:|..|:.. ||.||:|....:||..|..:::...:|:  
Human    13 FEKQFNENEAIQWMQENWKKSFLFSALYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFS-- 74

  Fly    69 IF---VWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQ 130
            ||   ..|.:::::.....|. ..|..|........:..:|.:.|:|..:|.||||.:|||  ::
Human    75 IFGALRTGAYMVYILMTKGLK-QSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRK--QK 136

  Fly   131 ITFLHVFHHVFMVFTSHMLIRFYGF-----GGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESL 190
            :.|||.:||:.:     :|..:|.:     ||..|:  ..|..||.|||.||  :.::...:.|.
Human   137 LIFLHWYHHITV-----LLYSWYSYKDMVAGGGWFM--TMNYGVHAVMYSYY--ALRAAGFRVSR 192

  Fly   191 WWKKYLTLGQLVQFLLMFLHCMYTYF------QPNC-SASRGVIYVISSASAFMFL----MFTKF 244
            .:..::||.|:.|   |.:.|:..|.      ...| |..:.:.:     |:.|:|    :|..|
Human   193 KFAMFITLSQITQ---MLMGCVVNYLVFCWMQHDQCHSHFQNIFW-----SSLMYLSYLVLFCHF 249

  Fly   245 YIKTYI 250
            :.:.||
Human   250 FFEAYI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 64/255 (25%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 64/254 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.