DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl7

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:270 Identity:94/270 - (34%)
Similarity:138/270 - (51%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ADP--VQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVI--- 69
            |||  ....|..|.....||:.:|:.||..||.|||:..:..:|:..:..||...|||:..:   
Mouse    21 ADPRVEDYLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFSVYMCYE 85

  Fly    70 FV---WGIHLLFVQKPYNLSCMQVLPQDHELKSTERTL-----SYMYHLNKVLDLMDTIFFVLRK 126
            ||   ||       ..|:..|..|     :...:.|.:     .::|:.:|.::|:|||||||||
Mouse    86 FVMSGWG-------TGYSFRCDIV-----DYSQSPRAMRMVHTCWLYYFSKFIELLDTIFFVLRK 138

  Fly   127 KQRQITFLHVFHHVFMVFTSHMLIRFYGFGG----HVFLICMFNVLVHIVMYGYYYASSQSQNVQ 187
            |..|:||||||||..|.:|....::| ..||    |.||    |..||:|||.||...:.....|
Mouse   139 KNSQVTFLHVFHHTIMPWTWWFGVKF-AAGGLGTFHAFL----NTAVHVVMYSYYGLCAMGPAYQ 198

  Fly   188 ESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSASRGV-IYVISSASAFMFLMFTKFYIKTYIR 251
            :.|||||:||..|||||:|:.:|....:|..:|:....| :|:|.|......|:|..|:.:.|.:
Mouse   199 KYLWWKKHLTSLQLVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAYTK 263

  Fly   252 ----PKEVKS 257
                ||.:::
Mouse   264 GQRLPKTLEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 91/260 (35%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 89/255 (35%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.