DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl5

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_030100414.1 Gene:Elovl5 / 68801 MGIID:1916051 Length:340 Species:Mus musculus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:128/271 - (47%) Gaps:42/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVFD-------KPFADPVQLPLAG------SIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGV 54
            |.||       |.|..|....:.|      .|.|.|..: :|||.|. ||.|.|...:....||:
Mouse    43 EHFDASLSTYFKAFLGPRDTRVKGWFLLDNYIPTFVCSV-IYLLIVW-LGPKYMKNRQPFSCRGI 105

  Fly    55 LKFYNIGQVLFNSVIF------VWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKV 113
            |:.||:|..|.:..:|      ||       :..||..|..............|.| :.|:.:|:
Mouse   106 LQLYNLGLTLLSLYMFYELVTGVW-------EGKYNFFCQGTRSAGESDMKIIRVL-WWYYFSKL 162

  Fly   114 LDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYY 178
            ::.|||.||:|||...|||.|||:||..|:.....::.:... ||.:.....|..:|::||.||.
Mouse   163 IEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPC-GHSYFGATLNSFIHVLMYSYYG 226

  Fly   179 ASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSASRG-----VIYVISSASAFMF 238
            .|| ..:::..||||||:|.||||||:|..:......|.| ||...|     :.|:||     :.
Mouse   227 LSS-IPSMRPYLWWKKYITQGQLVQFVLTIIQTTCGVFWP-CSFPLGWLFFQIGYMIS-----LI 284

  Fly   239 LMFTKFYIKTY 249
            .:||.|||:||
Mouse   285 ALFTNFYIQTY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 85/251 (34%)
Elovl5XP_030100414.1 ELO 68..302 CDD:366492 84/246 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.