DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and ELOVL1

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001243328.1 Gene:ELOVL1 / 64834 HGNCID:14418 Length:279 Species:Homo sapiens


Alignment Length:267 Identity:90/267 - (33%)
Similarity:140/267 - (52%) Gaps:29/267 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ADP-VQ-LPLAGS--IRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIF 70
            ||| :| .||.||  :.||:::..||  |||.||.::|...:..||||.:..||...|.. |:..
Human    15 ADPRIQGYPLMGSPLLMTSILLTYVY--FVLSLGPRIMANRKPFQLRGFMIVYNFSLVAL-SLYI 76

  Fly    71 VWGIHLLFVQKPYNLSCMQVLPQDHELKSTER----TLSYMYHLNKVLDLMDTIFFVLRKKQRQI 131
            |:...:......|...|.   |.|:. .|.|.    .:::::..:|.::||||:.|:||||..|:
Human    77 VYEFLMSGWLSTYTWRCD---PVDYS-NSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQV 137

  Fly   132 TFLHVFHHVFMVFTSHMLIRFYGF----GGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWW 192
            ||||||||..:.::     .::|.    ||......|.|..||::||.||..|:.....|..|||
Human   138 TFLHVFHHSVLPWS-----WWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWW 197

  Fly   193 KKYLTLGQLVQFLLMFLHCMYTYFQPNCSASRGV-IYVISSASAFMFLMFTKFYIKTYIR----P 252
            ||::|..||:||:|:.||....||..:|:....| |::|.......|::|:.|:..:|.:    |
Human   198 KKHMTAIQLIQFVLVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLP 262

  Fly   253 KEVKSKG 259
            :.::..|
Human   263 RALQQNG 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 85/255 (33%)
ELOVL1NP_001243328.1 ELO 23..260 CDD:307345 84/248 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.