DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and ELOVL5

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:271 Identity:80/271 - (29%)
Similarity:116/271 - (42%) Gaps:74/271 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIF--------------------- 70
            |.:|..|.::.||.|.|...:....||:|..||:|..|.:..:|                     
Human    37 ICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNLGLTLLSLYMFCESKREQPRRSACASRTDPST 101

  Fly    71 ------------VWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFV 123
                        ||       :..||..|..............|.| :.|:.:|:::.|||.||:
Human   102 QQQLPENRLVTGVW-------EGKYNFFCQGTRTAGESDMKIIRVL-WWYYFSKLIEFMDTFFFI 158

  Fly   124 LRKKQRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQE 188
            |||...|||.|||:||..|:.....::.:... ||.:.....|..:|::||.||..|| ..:::.
Human   159 LRKNNHQITVLHVYHHASMLNIWWFVMNWVPC-GHSYFGATLNSFIHVLMYSYYGLSS-VPSMRP 221

  Fly   189 SLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSASRGVI---------------YVISSASAFMF 238
            .||||||:|.|||:||:|       |..|.:|    |||               |:||     :.
Human   222 YLWWKKYITQGQLLQFVL-------TIIQTSC----GVIWPCTFPLGWLYFQIGYMIS-----LI 270

  Fly   239 LMFTKFYIKTY 249
            .:||.|||:||
Human   271 ALFTNFYIQTY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 80/271 (30%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 80/271 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.