DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl2

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:245 Identity:84/245 - (34%)
Similarity:120/245 - (48%) Gaps:24/245 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 IIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIG------QVLFNSVIFVWGIHLLFVQKPYN 84
            :.:|:.....:.||.|.|....|..|||.|..||:.      .:|...::..|       :..||
 Frog    39 LFLTLLYFLSIWLGTKYMQNRPAFSLRGHLIVYNLVVTLLSLYMLIELILSTW-------EGGYN 96

  Fly    85 LSCMQVLPQDHELKSTERT--LSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSH 147
            |.|..:   |...|:..|.  :.:.|:.:|.::.|||||||||||..|||||||:||..| |...
 Frog    97 LQCQNL---DSAGKADVRVAKVLWWYYFSKAIEFMDTIFFVLRKKNSQITFLHVYHHASM-FNIW 157

  Fly   148 MLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCM 212
            ..:..:...|..|.....|..:|::||. ||..|...::.:.||||:|||..|||||||...|.:
 Frog   158 WCVLNWIPCGQSFFGPTLNSFIHVLMYS-YYGLSVIPSMHKYLWWKRYLTQAQLVQFLLTITHTL 221

  Fly   213 YTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSKGKVN 262
            ....:| |....|.:...:|..|.:.::|..||:|||   |:..||...|
 Frog   222 SAAVKP-CGFPFGCLMFQASYMATLVILFVNFYLKTY---KKRPSKSDPN 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 81/238 (34%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.