DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl2

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:245 Identity:88/245 - (35%)
Similarity:124/245 - (50%) Gaps:25/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 IITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV------WGIHLLFVQKPYNL 85
            |:|:..|..:.||.|.|....||.|||:|..||:...|.::.:.|      |       :..|||
Mouse    40 ILTITYLLSIWLGNKYMKNRPALSLRGILTLYNLAITLLSAYMLVELILSSW-------EGGYNL 97

  Fly    86 SCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLI 150
            .| |.|....|.......:.:.|:.:|:::.:||||||||||..|||||||:||..| |.....:
Mouse    98 QC-QNLDSAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVYHHASM-FNIWWCV 160

  Fly   151 RFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTY 215
            ..:...|..|.....|..:||:||. ||..|...::.:.||||||||..|||||:|...|.:...
Mouse   161 LNWIPCGQSFFGPTLNSFIHILMYS-YYGLSVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAV 224

  Fly   216 FQPNCSASRGVIYVISSASAFMFLMFTKFYIKTY--------IRPKEVKS 257
            .:| |....|.:...||....:.::|..|||:||        ::.||||:
Mouse   225 VKP-CGFPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPVKKELQEKEVKN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 87/243 (36%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 84/234 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.