DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl2

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:237 Identity:87/237 - (36%)
Similarity:121/237 - (51%) Gaps:18/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV------WGIHLLFVQKPYNLS 86
            :|:..|..:.||.|.|....||.|||:|..||:|..|.::.:.|      |       :..|||.
  Rat    41 LTIVYLLSIWLGNKYMKNRPALSLRGILTLYNLGITLLSAYMLVELVLSSW-------EGGYNLQ 98

  Fly    87 CMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIR 151
            | |.|....|.......:.:.|:.:|:::.:||||||||||..|||||||:||..| |.....:.
  Rat    99 C-QNLDSAGEGDIRVAKVLWWYYFSKLVEFLDTIFFVLRKKTSQITFLHVYHHASM-FNIWWCVL 161

  Fly   152 FYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYF 216
            .:...|..|.....|..:||:||. ||..|...::...||||||||..|||||:|...|.:....
  Rat   162 NWIPCGQSFFGPTLNSFIHILMYS-YYGLSVFPSMHRYLWWKKYLTQAQLVQFVLTITHTLSAVV 225

  Fly   217 QPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSK 258
            :| |....|.:...||....:.::|..|||:|| |.|.:|.:
  Rat   226 KP-CGFPFGCLIFQSSYMMTLVILFLNFYIQTY-RKKPMKKE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 86/234 (37%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.