DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl5

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011248.1 Gene:elovl5 / 496694 XenbaseID:XB-GENE-952346 Length:295 Species:Xenopus tropicalis


Alignment Length:287 Identity:89/287 - (31%)
Similarity:128/287 - (44%) Gaps:54/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVFDKP---FADPVQLPLAGSIR--------TSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLK 56
            ||.||.   :.|.:..|....:|        ...|:.|...||::..|.|.|.....:..||:|.
 Frog     2 EVLDKAVNGYIDHLLGPKDPRVRGWLLLDNYVPTILFTALYLFIVWRGPKYMQNRPPVSCRGILV 66

  Fly    57 FYNIGQVLFNSVIF------VWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLD 115
            .||:|..|.:..:|      ||       :..||..|..............|.| :.|:.:|:::
 Frog    67 VYNLGLTLLSLYMFYELVTGVW-------EGGYNFFCQDTNSGGDADTKIVRVL-WWYYFSKLIE 123

  Fly   116 LMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYAS 180
            .|||.||:|||...|||.|||:||..|:.....::.:... ||.:.....|..:|::||. ||..
 Frog   124 FMDTFFFILRKNNHQITVLHVYHHASMLNIWWFVMNWVPC-GHSYFGATLNSFIHVLMYS-YYGL 186

  Fly   181 SQSQNVQESLWWKKYLTLGQLVQFLL--------MFLHCMY----TYFQPNCSASRGVIYVISSA 233
            |....::..||||||:|..||.||:|        |...|.:    .||| ||       |:||  
 Frog   187 SAIPAMRPYLWWKKYITQCQLTQFVLTMTQTTCAMIWPCKFPMGWLYFQ-NC-------YMIS-- 241

  Fly   234 SAFMFLMFTKFYIKTYIRPKEVKSKGK 260
               :.::|..||||||  .|:..|:.|
 Frog   242 ---LIILFGNFYIKTY--NKKTSSRRK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 82/266 (31%)
elovl5NP_001011248.1 ELO 28..261 CDD:366492 80/257 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 265..295
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.