DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl7

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001005456.1 Gene:elovl7 / 448054 XenbaseID:XB-GENE-942805 Length:299 Species:Xenopus tropicalis


Alignment Length:259 Identity:86/259 - (33%)
Similarity:132/259 - (50%) Gaps:17/259 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ADP--VQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVW 72
            |||  ...||..:.....|||..|:.||..||.::|:..:...|:.::..||:..||| |:...:
 Frog    21 ADPRVEDWPLMSTPIPQTIIIGAYIYFVTSLGPRIMENRKPFALKEIMACYNLFMVLF-SLYMCY 84

  Fly    73 GIHLLFVQKPYNLSCMQV----LPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITF 133
            ...:......|:..|..|    .||...:..|    .::::.:|.::|:||:|||||||..||||
 Frog    85 EFLMSGWAAGYSYRCDIVDYSQSPQALRMAWT----CWLFYFSKFIELLDTVFFVLRKKNSQITF 145

  Fly   134 LHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTL 198
            |||:||..|.:|....::| ..||......:.|.:||::||.||..|:.....|:.||||||:|.
 Frog   146 LHVYHHSIMPWTWWFGVKF-AAGGLGTFHALVNCVVHVIMYSYYGLSALGPAYQKYLWWKKYMTS 209

  Fly   199 GQLVQFLLMFLHCMYTYFQPNCSASRGV-IYVISSASAFMFLMFTKFYIKTYIR----PKEVKS 257
            .||.|||::..|....:|..||.....: :|||........|:|..|:...|.:    ||.:::
 Frog   210 IQLTQFLMVTFHIGQFFFMENCPYQYPIFLYVIWLYGFVFLLLFLNFWFHAYTKGQRLPKNLQN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 83/249 (33%)
elovl7NP_001005456.1 ELO 29..228 CDD:395916 71/204 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.