DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG6660

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651104.1 Gene:CG6660 / 42708 FlyBaseID:FBgn0039030 Length:272 Species:Drosophila melanogaster


Alignment Length:257 Identity:100/257 - (38%)
Similarity:149/257 - (57%) Gaps:11/257 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DP--VQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWG 73
            ||  ..|||.|::...:.|:.:|:.|||..|.:.|......:|:.|::.||:.|||.|:.|||.|
  Fly    18 DPRVAHLPLLGNLWIVLAIVALYVAFVLHYGPRWMANRAPFELKRVMQVYNVVQVLANATIFVIG 82

  Fly    74 IHLLFVQKPYNLSCMQVLPQDHELKSTE--RTL--SYMYHLNKVLDLMDTIFFVLRKKQRQITFL 134
            :...::|..|:.:|.   |.||..:|..  :||  ||.|::.|.|||:||:|.|||||..|::||
  Fly    83 LSNTYLQPGYSWTCQ---PVDHTDRSPAMMKTLYASYAYYMLKYLDLLDTVFIVLRKKNSQVSFL 144

  Fly   135 HVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLG 199
            ||:||..|||...:.:.|.| |.|..::.:.|:|||.|||.||||:|... |:..||||:.:|..
  Fly   145 HVYHHGGMVFGVSIFMTFLG-GSHCSMLGIINLLVHTVMYAYYYAASLGA-VKNLLWWKQRITQL 207

  Fly   200 QLVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSKGKV 261
            ||:||..:..|.:....:..|.....:.::....:.|||.||..||.|||||.:...::.|:
  Fly   208 QLMQFGYLTFHFLLVIVRNPCQFPVFIAFIGFIQNIFMFSMFFDFYCKTYIRKQRKSAEHKL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 96/244 (39%)
CG6660NP_651104.1 ELO 25..265 CDD:279492 96/244 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449553
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.