DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and bond

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:256 Identity:83/256 - (32%)
Similarity:129/256 - (50%) Gaps:16/256 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVFDKPFADPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNS 67
            |..|..|.....:|:       |.::.|||.||||:|.:.|...:.:.|:.::.|||..|||:: 
  Fly    21 ETVDSWFLMSSPMPV-------VAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYS- 77

  Fly    68 VIFVWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTL---SYMYHLNKVLDLMDTIFFVLRKKQR 129
               :|.......:.....|......:.:..:....||   ::.|..:|::||:||.|||||||..
  Fly    78 ---IWMCRTSIQESNVMASIFSKKCEINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDN 139

  Fly   130 QITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKK 194
            |::||||:||...|..|...:: |..|....:|.:.|..|||:||.||..::.....|:.|||||
  Fly   140 QVSFLHVYHHTITVLFSWGYLK-YAPGEQGVIIGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKK 203

  Fly   195 YLTLGQLVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEV 255
            |:|..||:||:|: |..|.|.....|:..:.:.:.....:.....:|..||.|||.:.|.|
  Fly   204 YMTSIQLIQFVLI-LGYMLTVGAKGCNMPKTLTFFFVGNTVIFLYLFGNFYRKTYKKAKSV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 80/243 (33%)
bondNP_651062.3 ELO 27..262 CDD:279492 79/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449562
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.