DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG9458

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster


Alignment Length:248 Identity:114/248 - (45%)
Similarity:168/248 - (67%) Gaps:0/248 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWGIH 75
            |||:|||..|.:..::::..||.||...|.|:|...:...|||::|.|||.|:::|.::..:.:|
  Fly    15 DPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVH 79

  Fly    76 LLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHV 140
            .:.....||..|::.||.|||.|:.||.|:|.|..||:|||::|:|||||||.|||:|||||||:
  Fly    80 FMLGPGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHM 144

  Fly   141 FMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFL 205
            :|::.|.|.:.:||:|||.|.:|.|||:|||:||.|||.||.:::.:..||||||:|:.||:||.
  Fly   145 YMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQFG 209

  Fly   206 LMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSK 258
            ::..|.:||..||:|.::|.......|.|....::|:.||...|||||:.|.|
  Fly   210 IVLGHSIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 108/240 (45%)
CG9458NP_731419.1 ELO 20..261 CDD:279492 108/240 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449530
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.