DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG8534

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster


Alignment Length:240 Identity:131/240 - (54%)
Similarity:171/240 - (71%) Gaps:1/240 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 DPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWGIH 75
            |||:|||.||...|:.|:::|||||||||||.|:..:...||.|::.|||.|:::|.||.:.|:|
  Fly    14 DPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLH 78

  Fly    76 LLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHV 140
            .|||.|.|:|.|:..||.||||||.||.|:|.|..||.:||::|:|||||||.|||:|||||||:
  Fly    79 FLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143

  Fly   141 FMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFL 205
            .|.|..::.|.|.|:||.:|.:|:.||.||::||.|||.||.|::||.|. ||||:|:.|||||:
  Fly   144 VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQFI 207

  Fly   206 LMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYI 250
            |:..:..||..||:|:|||.|||.....|....|||..|||..||
  Fly   208 LVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 127/235 (54%)
CG8534NP_649955.1 ELO 19..259 CDD:366492 127/235 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449529
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.