DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG31522

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001262254.1 Gene:CG31522 / 40567 FlyBaseID:FBgn0051522 Length:392 Species:Drosophila melanogaster


Alignment Length:276 Identity:87/276 - (31%)
Similarity:130/276 - (47%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV-------WG 73
            |:..|...::.:...|:..|..||.:||:..:.|.|:..|..||..||:|::.:|.       ||
  Fly    27 PMMSSPFPTLAVCLTYVYLVKVLGPRLMENRKPLNLQNTLVMYNAIQVVFSAWLFYECLMGGWWG 91

  Fly    74 IHLL------FVQKP--------------YNLSCMQVLPQDHELKSTERTL-----SYMYHLNKV 113
            .:..      :...|              |:..|..|     :..:..|||     .:.|:.:|.
  Fly    92 SYSFRCQPVDYTDSPTSRRIGISGWLTGHYSFRCQPV-----DYSNNPRTLRMVHACWWYYFSKF 151

  Fly   114 LDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYY 178
            .:.|||||||||||..|:|.|||.||..|..:....::|.. |||.....:.|..||||||.||.
  Fly   152 TEFMDTIFFVLRKKSSQVTTLHVIHHGCMPMSVWFGVKFTP-GGHSTFFGLLNTFVHIVMYTYYM 215

  Fly   179 ASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTK 243
            .|:.....|:.||||||||..|:|||:|:.:|.....| .:|:..:..::.|...:...|.:|.:
  Fly   216 FSAMGPQYQKYLWWKKYLTTLQMVQFILIMVHAFQLLF-IDCNYPKAFVWWIGMHAVMFFFLFNE 279

  Fly   244 FYIKTYIRPKEVKSKG 259
            ||...| |.:.:|..|
  Fly   280 FYKAAY-RSRMMKKNG 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 85/272 (31%)
CG31522NP_001262254.1 ELO 27..293 CDD:279492 86/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449631
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.