DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl4a

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_957090.1 Gene:elovl4a / 393769 ZFINID:ZDB-GENE-040426-1767 Length:309 Species:Danio rerio


Alignment Length:250 Identity:84/250 - (33%)
Similarity:125/250 - (50%) Gaps:9/250 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWGIHLLFVQ 80
            ||..|...::.|.:.|||| |.||.|.|...|..|||..|..||...|:.|..||.   .|....
Zfish    30 PLMDSPLPTLAISSSYLLF-LWLGPKYMQGREPFQLRKTLIIYNFSMVILNFFIFK---ELFLAA 90

  Fly    81 KPYNLS--CMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMV 143
            :..|.|  |..|...|...:.......:.|.::|.::.:||:||:||||..||:||||:||..| 
Zfish    91 RAANYSYICQPVDYSDDPNEVRVAAALWWYFISKGVEYLDTVFFILRKKFNQISFLHVYHHCTM- 154

  Fly   144 FTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMF 208
            ||...:...:..||..|.....|..:|::||.||..::....:|:.||||||||:.|:|||.:..
Zfish   155 FTLWWIGIKWVAGGQSFFGAHMNAAIHVLMYLYYGLAAFGPKIQKFLWWKKYLTIIQMVQFHVTI 219

  Fly   209 LHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIR-PKEVKSKGKVN 262
            .|...:.:. :|...:.:.:.:...:....::|..||.:||.| |:..|.:...|
Zfish   220 GHTALSLYS-DCPFPKWMHWCLIGYALTFIILFGNFYYQTYRRQPRRDKPRALHN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 82/243 (34%)
elovl4aNP_957090.1 ELO 30..267 CDD:279492 82/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.