powered by:
Protein Alignment CG16904 and CG32071
DIOPT Version :9
Sequence 1: | NP_649957.1 |
Gene: | CG16904 / 41212 |
FlyBaseID: | FBgn0037763 |
Length: | 262 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_729667.1 |
Gene: | CG32071 / 39246 |
FlyBaseID: | FBgn0052071 |
Length: | 150 |
Species: | Drosophila melanogaster |
Alignment Length: | 41 |
Identity: | 8/41 - (19%) |
Similarity: | 17/41 - (41%) |
Gaps: | 0/41 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 183 SQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSAS 223
:..::..:..:..|.|..::...|:.|....|...|..|:|
Fly 2 ASRIRREVTMRPILVLSLVILATLVVLSSQATSTSPTSSSS 42
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG16904 | NP_649957.1 |
ELO |
16..257 |
CDD:279492 |
8/41 (20%) |
CG32071 | NP_729667.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.