DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG32071

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729667.1 Gene:CG32071 / 39246 FlyBaseID:FBgn0052071 Length:150 Species:Drosophila melanogaster


Alignment Length:41 Identity:8/41 - (19%)
Similarity:17/41 - (41%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 SQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSAS 223
            :..::..:..:..|.|..::...|:.|....|...|..|:|
  Fly     2 ASRIRREVTMRPILVLSLVILATLVVLSSQATSTSPTSSSS 42

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 8/41 (20%)
CG32071NP_729667.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.