DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elo68beta

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097580.1 Gene:Elo68beta / 39245 FlyBaseID:FBgn0036128 Length:269 Species:Drosophila melanogaster


Alignment Length:270 Identity:84/270 - (31%)
Similarity:128/270 - (47%) Gaps:31/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EVFDKPFAD-----PVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQ 62
            |.:..||||     ....||..|....:.::.:|||.| :...|...:.:.||||..|..:::..
  Fly    12 ESYSYPFADLADERTQDWPLVKSPWNIIALLALYLLMV-RYAPKWTARCKPLQLRVPLFCHSLAM 75

  Fly    63 VLFNSVIFVWGIHLLFVQKP----YNLSCMQ--VLPQDHELKSTERTLSYMYHLNKVLDLMDTIF 121
            :..|..|.     |.|:...    ||.:|.:  |....||::..  ...:.::::|:|:.:||.|
  Fly    76 IFLNGYIC-----LEFLTASLSLGYNFACQECRVSHDPHEIRIA--AAMWWFYISKILEFVDTAF 133

  Fly   122 FVLRKKQRQITFLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNV 186
            |:||.|..|::||||:||..|.......:::...|. .|...|.|..||::||.||..|.....|
  Fly   134 FILRHKWNQLSFLHVYHHSTMFLFCWTYVKWLPTGS-TFFPSMINSFVHVIMYSYYALSVLGPRV 197

  Fly   187 QESLWWKKYLTLGQLVQFLLMFLHCMYTYFQPNCSASR-----GVIYVISSASAFMFLMFTKFYI 246
            |..||||:|||..|||||.::|.......|: .|...:     |..|::    .|:| ||.:||.
  Fly   198 QRFLWWKRYLTGLQLVQFTIIFFWASQLVFR-GCEYGKWLTPIGAAYMV----PFLF-MFGRFYA 256

  Fly   247 KTYIRPKEVK 256
            :.|.....||
  Fly   257 QKYCVSAVVK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 79/252 (31%)
Elo68betaNP_001097580.1 ELO 48..267 CDD:279492 73/234 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473103
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.