DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and tea

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:101 Identity:22/101 - (21%)
Similarity:38/101 - (37%) Gaps:31/101 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FVQKPYNLSCMQVLPQD-------------HELKSTERTLSY-------MYHLNKVL-------- 114
            |..:|:....: |:|:|             |||:.||....|       :|.|:..|        
  Fly   960 FQPEPFPEDAL-VVPEDVTTNQGTQPLELQHELEVTEPIKDYIQLNAERLYELSSKLKIGWNYTA 1023

  Fly   115 -DLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHML 149
             :.:|.:|..:.....| .||...:..:.|.|.|::
  Fly  1024 HNFLDKLFKGINCPVTQ-AFLEEQYKRYSVSTGHIV 1058

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 22/101 (22%)
teaNP_724855.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.