DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elo68alpha

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_729666.2 Gene:Elo68alpha / 317841 FlyBaseID:FBgn0052072 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:90/264 - (34%)
Similarity:136/264 - (51%) Gaps:26/264 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DKPFADPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIF 70
            |:|.......||..|..|..:::::|||.| :...|...:|:.||||..|..:::..|..|..|.
  Fly    13 DQPDERTRNWPLVDSFWTVPVLLSIYLLMV-RYAPKWTTRHKPLQLRAPLFCHSLAMVFLNGYIC 76

  Fly    71 VWGIHLLFVQKPYNLSCM--QVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITF 133
            : .::.......||..|.  :|....||::.|:  ..:.::::|:|:..||.||:||:|..|::|
  Fly    77 L-ELYAATRDLDYNFGCQPCRVSFDPHEMRLTK--AFWWFYISKILEFADTAFFILRQKWSQLSF 138

  Fly   134 LHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTL 198
            |||:||..|.....:||::...|. .::..|.|..|||:|||||..|.....||..||||:|||.
  Fly   139 LHVYHHSTMFVFCWILIKWMPTGS-TYVPAMINSFVHIIMYGYYALSVLGPRVQRFLWWKRYLTG 202

  Fly   199 GQLVQFLLMFLHCMYTYFQPNCSASRGVIY----VISSA---SAFMFLMFTKFYIKTYIRPKEVK 256
            .|||||.::|       |..:....||..|    .:|.|   ..|:| ||.|||::.|    .|.
  Fly   203 LQLVQFTIIF-------FWASQMLVRGCEYGTWITLSMAIYSLPFLF-MFGKFYMQKY----TVS 255

  Fly   257 SKGK 260
            :.||
  Fly   256 AVGK 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 86/249 (35%)
Elo68alphaNP_729666.2 ELO 23..260 CDD:279492 88/254 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473102
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.