DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and CG30008

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:254 Identity:67/254 - (26%)
Similarity:113/254 - (44%) Gaps:41/254 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 VIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYN----------IGQVLF---NSVIFVW---- 72
            :.::.:||.||.|.|...|:..:..:|:.::..:|          |.:||:   |::...|    
  Fly    26 ITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVVSCIYAIKEVLYITDNTIYIFWKCRD 90

  Fly    73 -GIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHV 136
             |.....|::.||                   |:|.....|:.:|::|:.|||||||.|::.||:
  Fly    91 IGSSPELVRRYYN-------------------LAYFLFWLKISELIETVIFVLRKKQNQVSKLHI 136

  Fly   137 FHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQN--VQESLWWKKYLTLG 199
            |||...|...:.||.|...|...:.....|.:||::||.||:.::.:..  ||.....||.:|:.
  Fly   137 FHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKKCITVI 201

  Fly   200 QLVQFLLMFLHCMYTYFQPNCSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVKSK 258
            |:.||:|:.....:....  |.....|:...::....||..|..||...|...:..||:
  Fly   202 QMTQFVLILTQVAFQLVL--CGMPPLVLLYFTTVILGMFYGFYDFYNSAYQASQRRKSQ 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 65/251 (26%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449571
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.