DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elo-9

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_497086.1 Gene:elo-9 / 190207 WormBaseID:WBGene00001247 Length:286 Species:Caenorhabditis elegans


Alignment Length:243 Identity:61/243 - (25%)
Similarity:110/243 - (45%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 SVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFVWGIHLLFVQKPYNLS-- 86
            ||.:...|:: ...|.::.|:..:...:|.:|..:| |.:...|::..|...:.|....:...  
 Worm    52 SVYLSAAYII-ATNLLQRYMESRKPKSMRPLLLAWN-GFLAVFSIMGTWRFGIEFYDAVFRRGFI 114

  Fly    87 ---CMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHH-VFMVFTSH 147
               |:.|.|     :|.....:.|:.|:|:.:..||:|.||||  |.:.|||.:|| |.::.:.|
 Worm   115 DSICLAVNP-----RSPSAFWACMFALSKIAEFGDTMFLVLRK--RPVIFLHWYHHAVVLILSWH 172

  Fly   148 MLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLL-MFLHC 211
            ..|.... .|..|:  ..|.|||.:||.||..:|....:.:.:  ...:|..|.:|.|: :.:.|
 Worm   173 AAIELTA-PGRWFI--FMNYLVHSIMYTYYAITSIGYRLPKIV--SMTVTFLQTLQMLIGVSISC 232

  Fly   212 MYTYFQPN---CSASRGVIYVISSASAFMFLMFTKFYIKTYIRPKEVK 256
            :..|.:.|   |..|...:.:.....|...::|:.|:...|:..|:.|
 Worm   233 IVLYLKLNGEMCQQSYDNLALSFGIYASFLVLFSSFFNNAYLVKKDKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 61/243 (25%)
elo-9NP_497086.1 ELO 44..274 CDD:279492 58/235 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.