DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elo-1

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:154 Identity:45/154 - (29%)
Similarity:77/154 - (50%) Gaps:19/154 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 YMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVF-MVFT--SHMLIRFYGFGGH-VFLICMFN 166
            :::..:|:.:|:||||.||||  |.:.|||.:||:. |::.  ||.|..  ||..: ::|    |
 Worm   128 WLFMASKLFELVDTIFLVLRK--RPLMFLHWYHHILTMIYAWYSHPLTP--GFNRYGIYL----N 184

  Fly   167 VLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLL---MFLHCMYT--YFQPNCSASRGV 226
            .:||..||.||:..|....|...:  .:.:|..|:|||::   :..|..|.  :...||.....|
 Worm   185 FVVHAFMYSYYFLRSMKIRVPGFI--AQAITSLQIVQFIISCAVLAHLGYLMHFTNANCDFEPSV 247

  Fly   227 IYVISSASAFMFLMFTKFYIKTYI 250
            ..:..........:|..|::::|:
 Worm   248 FKLAVFMDTTYLALFVNFFLQSYV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 45/154 (29%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 45/154 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.