DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl6

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:274 Identity:71/274 - (25%)
Similarity:122/274 - (44%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDKPFADPVQLP-LAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSV 68
            |:|.|.:...:. :..:.:.|.:...:|..|:.. ||.||:|....:||..|..:::...:|:  
  Rat    13 FEKQFNENEAIQWMQENWKKSFLFSALYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFS-- 74

  Fly    69 IF---VWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQ 130
            ||   ..|.::|::.....|. ..|..|........:..:|.:.|:|..:|.||||.:|||  ::
  Rat    75 IFGALRTGAYMLYILMTKGLK-QSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRK--QK 136

  Fly   131 ITFLHVFHHVFMVFTSHMLIRFYGF-----GGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESL 190
            :.|||.:||:.:     :|..:|.:     ||..|:  ..|..||.|||.||  :.::...:.|.
  Rat   137 LIFLHWYHHITV-----LLYSWYSYKDMVAGGGWFM--TMNYGVHAVMYSYY--ALRAAGFRVSR 192

  Fly   191 WWKKYLTLGQLVQFLLMFLHCMYTYFQPN--------CSASRGVIYVISSASAFMFLMFTKFYIK 247
            .:..::||.|:.|   |.:.|:..|...|        |.:....|:..|.......|:|..|:.:
  Rat   193 KFAMFITLSQITQ---MLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFE 254

  Fly   248 TYIRPKEVKSKGKV 261
            .||        |||
  Rat   255 AYI--------GKV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 65/257 (25%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 68/262 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.