DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and Elovl3

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_031729.1 Gene:Elovl3 / 12686 MGIID:1195976 Length:271 Species:Mus musculus


Alignment Length:283 Identity:68/283 - (24%)
Similarity:126/283 - (44%) Gaps:56/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 FEVFD--KPFADPVQLPLAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVL 64
            ||.|.  :||.:...:       :|.:|:.||||.:: :|:..|...::..|:..|..::....:
Mouse    21 FETFQDLRPFLEEYWV-------SSFLIVVVYLLLIV-VGQTYMRTRKSFSLQRPLILWSFFLAI 77

  Fly    65 FN------------SVIFVWGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLM 117
            |:            :|:|..|:.        ...|..:...|    :..|..|:::.|:||::|.
Mouse    78 FSILGTLRMWKFMATVMFTVGLK--------QTVCFAIYTDD----AVVRFWSFLFLLSKVVELG 130

  Fly   118 DTIFFVLRKKQRQITFLHVFHH-VFMVFTSHMLIRFYGF-----GGHVFLICMFNVLVHIVMYGY 176
            ||.|.:|||  |.:.|:|.:|| ..::|||      :|:     .|..|:...|.  ||.|||.|
Mouse   131 DTAFIILRK--RPLIFVHWYHHSTVLLFTS------FGYKNKVPSGGWFMTMNFG--VHSVMYTY 185

  Fly   177 YYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYF---QPNCSASRGVIYVISSASAFMF 238
            |  :.::..::........:|..|::|.:|..:..:..|.   :..|..:....:.........|
Mouse   186 Y--TMKAAKLKHPNLLPMVITSLQILQMVLGTIFGILNYIWRQEKGCHTTTEHFFWSFMLYGTYF 248

  Fly   239 LMFTKFYIKTYIRPK-EVKSKGK 260
            ::|..|:.:.|:||| :|.||.:
Mouse   249 ILFAHFFHRAYLRPKGKVASKSQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 61/262 (23%)
Elovl3NP_031729.1 ELO 52..267 CDD:366492 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.