DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl3

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_002935809.1 Gene:elovl3 / 100497108 XenbaseID:XB-GENE-977704 Length:270 Species:Xenopus tropicalis


Alignment Length:239 Identity:58/239 - (24%)
Similarity:110/239 - (46%) Gaps:42/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV---WGIHLLFVQKPYNLS-CMQVLPQDHELKS 99
            |:::|.:....:||..|..::....:|:.:..|   |.:..:.:...:..| |      |....|
 Frog    53 GQRMMKERRRFELRRPLVLWSFTLAVFSIIGAVRTGWFMGNILITNGFKQSVC------DRAFYS 111

  Fly   100 --TERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIRFYGF-----GG 157
              ..:..:|.:.|:||.:|.||:|.||||  :::.|||.:||:.:     :|..:|.:     ||
 Frog   112 GPVSKFWAYAFVLSKVPELGDTLFIVLRK--QKLIFLHWYHHITV-----LLYTWYTYKDTVAGG 169

  Fly   158 HVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFL--HCMYTYFQP-N 219
            ..|:  ..|..||..||.||...:....|....  ..::|..|::|.::..:  ..:|::.|. :
 Frog   170 GWFM--TMNYTVHAFMYSYYTLRAAGIRVPRPC--AMFITFTQILQMVMGIVVNALVYSWRQDGS 230

  Fly   220 C-SASRGVIYVISSASAFM----FLMFTKFYIKTYIRPKEVKSK 258
            | |.:..:.:     |..|    |::|..|:.|.|:: ..:|:|
 Frog   231 CLSTTENIFW-----SCLMYFSYFILFCSFFYKAYLK-YPIKNK 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 56/236 (24%)
elovl3XP_002935809.1 ELO 31..262 CDD:366492 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.