DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16904 and elovl6l

DIOPT Version :9

Sequence 1:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:260 Identity:62/260 - (23%)
Similarity:117/260 - (45%) Gaps:16/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 FDKPFADPVQLP-LAGSIRTSVIIITVYLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSV 68
            |::.|.:.:.:. :..:.:.|.:...||::.|.. |:..|...:.|.||.||..:::...:|:.:
Zfish    15 FERHFDERLAIEWMQDNWKKSFLFGAVYVVLVFG-GQHFMKDRQRLDLRKVLMMWSLSLAIFSII 78

  Fly    69 IFV-WGIHLLFVQKPYNLSCMQVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQIT 132
            ..| .|..:|::....... ..|..|........:..:..:.|:|..:|.||:|.||||  :::.
Zfish    79 GAVRTGCFMLYILSTSGFK-QSVCDQSFYYGPISKFWACAFVLSKAPELGDTMFIVLRK--QRLI 140

  Fly   133 FLHVFHHVFMVFTSHMLIRFYGFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLT 197
            |||.:||:.::..|....:....||..|:  ..|..||.:||.||.|.:....|.:..  ...:|
Zfish   141 FLHWYHHITVLVYSWYSYKDQVAGGGWFM--TMNYTVHALMYSYYAARAAGLRVPKPC--AILIT 201

  Fly   198 LGQLVQFL--LMFLHCMYTYFQP-NCSASRGVIYVISSASAFMFLMFTKFYIKTYI---RPKEVK 256
            ..|:.|..  |.....:|.:.|. :|.:....|...|.......|:|:.|:.::|:   :|:.:|
Zfish   202 SSQIAQMAMDLAVSALVYRWMQDGDCPSYLDNIVWASLMYLSYLLLFSSFFYQSYMKSSKPESIK 266

  Fly   257  256
            Zfish   267  266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16904NP_649957.1 ELO 16..257 CDD:279492 60/249 (24%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 59/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.