DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl4

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:261 Identity:89/261 - (34%)
Similarity:139/261 - (53%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVL 75
            |::.:||.|:.....|||||. ||||.|:.|:||.:..|:.|||...:|.|          ||:.
Mouse    41 PLMQSPWPTISISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLN----------LFIF 94

  Fly    76 K---------AYQISCIVSLPMDHKYKDRE-RLICTL--YLVNKFVDLVETIFFVLRKKDRQISF 128
            :         .|...|   ..:|:.....| |:...|  |.|:|.|:.::|:||:||||:.|:||
Mouse    95 RELFMGSYNAGYSYIC---QSVDYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSF 156

  Fly   129 LHVFHH---FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKY 190
            |||:||   |.:.:.|..:..    ||.||....:|:.:|||||:||.|::....:|:.||||:|
Mouse   157 LHVYHHCTMFTLWWIGIKWVA----GGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRY 217

  Fly   191 ITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAKQN 255
            :|:.|||||.:.:.|..::| ..:|...:.:.:...:.:..|..:|..||...|.:|  |.:|..
Mouse   218 LTMLQLVQFHVTIGHTALSL-YTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEP--KQSKTG 279

  Fly   256 K 256
            |
Mouse   280 K 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 87/255 (34%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 87/256 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 4/10 (40%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.