DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and HOS3-1

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:165 Identity:33/165 - (20%)
Similarity:65/165 - (39%) Gaps:33/165 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 AYQISCIVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFG 141
            |..:..::..|:..:...|......::.:.:|:.:..|||.|||  .|:::...:|.:..|||..
plant   110 ATPLQWLLCFPLGTRPSGRVFFWSYVFYLTRFLHMFRTIFAVLR--SRRLAVSQLFCNSVMAFTS 172

  Fly   142 YLYYCF-HGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLW---------WKKYITIAQL 196
            :|:..| ..|..:|.   |..|.|:.::|.|.:            |         :..::...||
plant   173 FLWLEFSQSYQILAI---LSTTLVYSVVYGYRF------------WTGFGLPGSAFPSFVVNCQL 222

  Fly   197 VQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAF 231
            |     |:.|.: ::............||..:.|:
plant   223 V-----LVGCNL-VSHAGVLTMHLFKGGCNGIGAW 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 33/165 (20%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.