DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and ELOVL6

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001124193.1 Gene:ELOVL6 / 79071 HGNCID:15829 Length:265 Species:Homo sapiens


Alignment Length:248 Identity:55/248 - (22%)
Similarity:104/248 - (41%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLLFVLKLGPKIMEHRKPFHLNG-------VIRIYNIFQILYNGLILVLGVHFLFVLKAYQISCI 83
            |..|:.. |..:|..|..|.|..       .:.:::||..|..|              ||.:..:
Human    40 YAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTG--------------AYMVYIL 89

  Fly    84 VSLPMDHKYKDR-------ERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFG 141
            ::..:.....|:       .:.....::::|..:|.:|||.:|||  :::.|||.:||..:..:.
Human    90 MTKGLKQSVCDQGFYNGPVSKFWAYAFVLSKAPELGDTIFIILRK--QKLIFLHWYHHITVLLYS 152

  Fly   142 YLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIILLHC 206
            :..|.....||..|  ..:|..||.:||:||.|.:....|.|.  :..:||::|:.|   :|:.|
Human   153 WYSYKDMVAGGGWF--MTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLSQITQ---MLMGC 210

  Fly   207 TIT------LAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAK 253
            .:.      :....|..:....:....:...:.|:|..|::..||...:|:.|
Human   211 VVNYLVFCWMQHDQCHSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKMRKTTK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 54/245 (22%)
ELOVL6NP_001124193.1 ELO 25..260 CDD:395916 53/243 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.