DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl5

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:XP_030100414.1 Gene:Elovl5 / 68801 MGIID:1916051 Length:340 Species:Mus musculus


Alignment Length:257 Identity:87/257 - (33%)
Similarity:126/257 - (49%) Gaps:59/257 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKAYQISCIVSLPMDH 90
            |||.|. ||||.|::|:||...|::::||:      ||.|         |..|....:|:...:.
Mouse    83 YLLIVW-LGPKYMKNRQPFSCRGILQLYNL------GLTL---------LSLYMFYELVTGVWEG 131

  Fly    91 KY-----------KDRERLICTL--YLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGY 142
            ||           :...::|..|  |..:|.::.::|.||:|||.:.||:.|||:||..|....:
Mouse   132 KYNFFCQGTRSAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWW 196

  Fly   143 LYY----CFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIIL 203
            ...    |.|.|.|..     ||:.:||:||:||.|||| ..::..||||||||..|||||    
Mouse   197 FVMNWVPCGHSYFGAT-----LNSFIHVLMYSYYGLSSI-PSMRPYLWWKKYITQGQLVQF---- 251

  Fly   204 LHCTITLAQPNCAVNRPLTYGCGSLSAFFAV--------IFSQFYYHNYIKPGKKSAKQNKN 257
               .:|:.|..|.|..|.::..|.|  ||.:        :|:.||...|   .||.|.:.|:
Mouse   252 ---VLTIIQTTCGVFWPCSFPLGWL--FFQIGYMISLIALFTNFYIQTY---NKKGASRRKD 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 85/250 (34%)
Elovl5XP_030100414.1 ELO 68..302 CDD:366492 86/252 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.