DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and elovl1

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001016644.1 Gene:elovl1 / 549398 XenbaseID:XB-GENE-1014374 Length:290 Species:Xenopus tropicalis


Alignment Length:255 Identity:89/255 - (34%)
Similarity:141/255 - (55%) Gaps:26/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFV- 74
            |::.:|::....|:.|:.|||.|||:||.:||||.|..::.:||...:..:..|:   ..||.. 
 Frog    27 PLMQSPFLPGAILLSYVYFVLSLGPRIMANRKPFDLKPLMVVYNFSLVALSAYIV---YEFLMSG 88

  Fly    75 -LKAYQISC----IVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHH 134
             |..|...|    :...||    ..|...:..|:|.:||::|::|:|||:|||:.||:|||:|||
 Frog    89 WLTGYTWRCDPVDVSDTPM----ALRMVRVAWLFLFSKFIELLDTVFFVVRKKNSQITFLHIFHH 149

  Fly   135 FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQF 199
            ..:.:..:....| |.||:.....::|:.||||||.||.||:.....|:.|||||::|..||:||
 Frog   150 SVLPWSWWWGVKF-GPGGMGSFHAMINSLVHVIMYFYYGLSAAGPRFQKYLWWKKHMTAIQLIQF 213

  Fly   200 AIILLHCTITLAQPNCAVNRPL------TYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAK 253
            .::.:|.:......:|....|:      .||    :.|| ::||.|:|..|.| |::..|
 Frog   214 VLVSIHISQYYFMSSCDYQYPIFIHLIWIYG----TVFF-ILFSNFWYQAYTK-GRRLPK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 88/252 (35%)
elovl1NP_001016644.1 ELO 27..267 CDD:395916 88/253 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.