DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl2

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:249 Identity:86/249 - (34%)
Similarity:130/249 - (52%) Gaps:33/249 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKA----YQISCIV 84
            |.|||.:. ||.|.|::|....|.|::.:||:...|.:..:||     ..:|.:    |.:.|  
Mouse    43 ITYLLSIW-LGNKYMKNRPALSLRGILTLYNLAITLLSAYMLV-----ELILSSWEGGYNLQC-- 99

  Fly    85 SLPMDHKYKDRERLICTL--YLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGYLYYCF 147
             ..:|...:...|:...|  |..:|.|:.::|||||||||..||:||||:||.:|  |. :::|.
Mouse   100 -QNLDSAGEGDVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQITFLHVYHHASM--FN-IWWCV 160

  Fly   148 HGY--GGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIILLHCTITL 210
            ..:  .|.:|....||:.:|::||:||.| |:...:.:.||||||:|.||||||.:.:.|....:
Mouse   161 LNWIPCGQSFFGPTLNSFIHILMYSYYGL-SVFPSMHKYLWWKKYLTQAQLVQFVLTITHTLSAV 224

  Fly   211 AQPNCAVNRPLTYGC----GSLSAFFAVIFSQFYYHNY-IKPGKK--SAKQNKN 257
            .:| |.    ..:||    .|......::|..||...| .||.||  ..|:.||
Mouse   225 VKP-CG----FPFGCLIFQSSYMMTLVILFLNFYIQTYRKKPVKKELQEKEVKN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 83/242 (34%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 81/238 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.