DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl1

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001034265.1 Gene:Elovl1 / 54325 MGIID:1858959 Length:279 Species:Mus musculus


Alignment Length:264 Identity:89/264 - (33%)
Similarity:147/264 - (55%) Gaps:37/264 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFV- 74
            |::.:|.:....|:.|:.|:|.|||:||.:||||.|.|       |.|:||..:::|.::.::. 
Mouse    23 PLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRG-------FMIVYNFSLVILSLYIVYEF 80

  Fly    75 -----LKAYQISCIVSLPMDHKYKDRERL----ICTLYLVNKFVDLVETIFFVLRKKDRQISFLH 130
                 |..|...|.   |:|.. ...|.|    :..|::::|.::|::|:.|:|||||.|::|||
Mouse    81 LMSGWLSTYTWRCD---PIDFS-NSPEALRMVRVAWLFMLSKVIELMDTVIFILRKKDGQVTFLH 141

  Fly   131 VFHHFAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQ 195
            ||||..:. :.:.:......||:.....::|::|||:||.||.||::....|..|||||::|..|
Mouse   142 VFHHSVLP-WSWWWGIKIAPGGMGSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQ 205

  Fly   196 LVQFAIILLHCTITLAQPNCAVNRPL------TYGCGSLSAFFAVIFSQFYYHNYIKPGK---KS 251
            |:||.::.||.:.....|:|....|:      .||     ..|.::||.|:||:|.| ||   ::
Mouse   206 LIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYG-----TIFFILFSNFWYHSYTK-GKRLPRA 264

  Fly   252 AKQN 255
            .:||
Mouse   265 VQQN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 87/259 (34%)
Elovl1NP_001034265.1 ELO 23..260 CDD:366492 86/254 (34%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.