DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and CG33110

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_788716.1 Gene:CG33110 / 42659 FlyBaseID:FBgn0053110 Length:337 Species:Drosophila melanogaster


Alignment Length:260 Identity:89/260 - (34%)
Similarity:134/260 - (51%) Gaps:24/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DP--VKIPVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLI---- 64
            ||  .:.|::.:|..|.|.:..||.:||.:||..|..||||.|...:.:||.||:..:|.:    
  Fly    54 DPRAKRFPLMEHPMFTFGMVAVYLSWVLVIGPLFMRDRKPFQLRRTLVVYNAFQVALSGYMFYEH 118

  Fly    65 LVLGVHFLFVLKAYQISCIVSLPMDHKYKD-----RERLICTLYLVNKFVDLVETIFFVLRKKDR 124
            |:.|     .|..|.:.|   .|:|  |.|     |...:|.||.::|..:..:|:|||||||..
  Fly   119 LMAG-----WLNYYNLKC---QPVD--YSDSPSSKRMLNLCYLYYLSKLTEFADTMFFVLRKKSS 173

  Fly   125 QISFLHVFHHFAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKK 189
            ||::|||:||.......::...|...|...||. |||..|||.||.||.::::..|..:.|||||
  Fly   174 QITWLHVYHHSVTPLETWVLVKFLAGGNATFPN-LLNNFVHVCMYFYYMMAAMGPEYAKFLWWKK 237

  Fly   190 YITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAKQ 254
            |:|..|:.||.:.:.|....|....|..::.::......::.|..:|..||..:|.|  .|:|:|
  Fly   238 YMTELQIAQFVLCIFHTLRALFSNQCQFSKFISALLLLNASIFFCLFMNFYMQSYRK--TKAAQQ 300

  Fly   255  254
              Fly   301  300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 85/249 (34%)
CG33110NP_788716.1 ELO 61..294 CDD:279492 83/243 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449590
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 1 0.950 - 0 Normalized mean entropy S2831
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.850

Return to query results.
Submit another query.