DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and ELOVL

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster


Alignment Length:276 Identity:90/276 - (32%)
Similarity:137/276 - (49%) Gaps:59/276 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFV- 74
            |::|:|:.|:...:.|...|..||||:||:||||.|..|:.:||..|::::.        :||. 
  Fly    27 PLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSA--------WLFYE 83

  Fly    75 ------LKAYQISCIVSLPMDHKYKD---RERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLH 130
                  |..|.:.|   .|:::.|..   |....|..|..:||.:..:|.|||:||:..|:|.||
  Fly    84 SCIGGWLNGYNLRC---EPVNYSYSPKAIRTAEGCWWYYFSKFTEFFDTFFFVMRKRYDQVSTLH 145

  Fly   131 VFHHFAM----------------AFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISK 179
            |.||..|                .|||:                 |||.||:.|||||.|:::..
  Fly   146 VIHHGIMPVSVWWGVKFTPGGHSTFFGF-----------------LNTFVHIFMYAYYMLAAMGP 193

  Fly   180 EVQRSLWWKKYITIAQLVQFAIILLHCTITLAQPNCAVNRPL--TYGCGSLSAFFAVIFSQFYYH 242
            :||:.||||||:|:.|::||.::::|......:.:|  |.|:  .|..|:.:..|..:||.||..
  Fly   194 KVQKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDC--NYPIGFAYFIGAHAVMFYFLFSNFYKR 256

  Fly   243 NYIK-PGKKSAKQNKN 257
            .|:| .||..|....|
  Fly   257 AYVKRDGKDKASVKAN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 88/269 (33%)
ELOVLNP_649754.1 ELO 27..266 CDD:366492 88/268 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449653
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1110.930

Return to query results.
Submit another query.