DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and CG18609

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:253 Identity:111/253 - (43%)
Similarity:158/253 - (62%) Gaps:3/253 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DPVKIPVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVH 70
            ||..||:..:||.....||.|||||||||...|.:|||:.|..|:::||:||:|||||...:..:
  Fly    11 DPNPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFY 75

  Fly    71 FLFVLKAYQISCIVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHF 135
            :||::....:.||.|.|..|:.|..||::...||:||.:||::|:||||||..:||:|||::||.
  Fly    76 YLFIVGICNLHCIESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITFLHIYHHV 140

  Fly   136 AMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFA 200
            .|:|..|....::|.||......|||:.||.:||.||:|||....|:.::|||||||:.||.||.
  Fly   141 FMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQLCQFF 205

  Fly   201 IILLHCT-ITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKP--GKKSAKQN 255
            ::|.:.. :....|||.|.|.|.|........|..:|.:||..||::|  .|.:|||:
  Fly   206 MLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYLRPPKAKINAKQS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 105/243 (43%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 104/240 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449542
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R389
SonicParanoid 1 1.000 - - X54
1211.830

Return to query results.
Submit another query.