DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl7

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001178773.1 Gene:Elovl7 / 361895 RGDID:1310560 Length:281 Species:Rattus norvegicus


Alignment Length:270 Identity:99/270 - (36%)
Similarity:147/270 - (54%) Gaps:42/270 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGT------LIG-YLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLG 68
            |.|.| |:.|.:      ::| |:.||..||||:||:||||.|...:..||.|.:|::     :.
  Rat    23 PRVEN-WLLMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFS-----VY 81

  Fly    69 VHFLFVLK----AYQISCIVSLPMDHKYKDRE-RLI--CTLYLVNKFVDLVETIFFVLRKKDRQI 126
            :.:.||:.    .|...|.:   :|:....|. |::  |.||..:||::|.:|||||||||:.|:
  Rat    82 MCYEFVMSGWGTGYSFRCDI---VDYSQSPRAMRMVHTCWLYYFSKFIELFDTIFFVLRKKNSQV 143

  Fly   127 SFLHVFHHFAMA---FFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWK 188
            :|||||||..|.   :||..:    ..||:.....||||||||:||.||.|.::....|:.||||
  Rat   144 TFLHVFHHTIMPWTWWFGVKF----AAGGLGTFHALLNTAVHVVMYFYYGLCAMGPAYQKYLWWK 204

  Fly   189 KYITIAQLVQFAIILLHCTITLAQPNCAVNRP------LTYGCGSLSAFFAVIFSQFYYHNYIKP 247
            |::|..|||||.::.:|........:|....|      ::|||     .|.::|..|:|..|.| 
  Rat   205 KHLTSLQLVQFVLVTVHIGQIFFMEDCNYQYPVFLYIIMSYGC-----IFLLLFLHFWYRAYTK- 263

  Fly   248 GKKSAKQNKN 257
            |::..|..:|
  Rat   264 GQRLPKTMEN 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 97/263 (37%)
Elovl7NP_001178773.1 ELO 30..269 CDD:395916 93/256 (36%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.