powered by:
Protein Alignment eloF and tea
DIOPT Version :9
Sequence 1: | NP_649956.1 |
Gene: | eloF / 41211 |
FlyBaseID: | FBgn0037762 |
Length: | 257 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_724855.2 |
Gene: | tea / 36027 |
FlyBaseID: | FBgn0285892 |
Length: | 1878 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 15/71 - (21%) |
Similarity: | 25/71 - (35%) |
Gaps: | 25/71 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 181 VQRSLWWKKYITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYI 245
:.:.|.:||.:...: ||.:.|:... .|.|| ..:||...|:
Fly 159 INKMLLFKKIVRSIE---------HCLVLLSDDE---RRLLT-------------LQRFYNRFYM 198
Fly 246 KPGKKS 251
.|.|:|
Fly 199 YPEKRS 204
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
eloF | NP_649956.1 |
ELO |
11..252 |
CDD:279492 |
15/71 (21%) |
tea | NP_724855.2 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3071 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.