DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and tea

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:71 Identity:15/71 - (21%)
Similarity:25/71 - (35%) Gaps:25/71 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 VQRSLWWKKYITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYI 245
            :.:.|.:||.:...:         ||.:.|:...   .|.||             ..:||...|:
  Fly   159 INKMLLFKKIVRSIE---------HCLVLLSDDE---RRLLT-------------LQRFYNRFYM 198

  Fly   246 KPGKKS 251
            .|.|:|
  Fly   199 YPEKRS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 15/71 (21%)
teaNP_724855.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.