DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl4

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001178725.1 Gene:Elovl4 / 315851 RGDID:1305630 Length:314 Species:Rattus norvegicus


Alignment Length:263 Identity:90/263 - (34%)
Similarity:140/263 - (53%) Gaps:35/263 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 PVVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVL 75
            |::.:||.|:.....|||||. ||||.|:.|:||.:..|:.|||...:|.|          ||:.
  Rat    41 PLMQSPWPTLSISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLN----------LFIF 94

  Fly    76 K---------AYQISCIVSLPMDHKYKDRE-RLICTL--YLVNKFVDLVETIFFVLRKKDRQISF 128
            :         .|...|   ..:|:.....| |:...|  |.|:|.|:.::|:||:||||:.|:||
  Rat    95 RELFMGSYNAGYSYIC---QSVDYSNDVNEVRIAAALWWYFVSKGVEYLDTVFFILRKKNNQVSF 156

  Fly   129 LHVFHH---FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKY 190
            |||:||   |.:.:.|..:..    ||.||....:|:.:|||||:||.|::....:|:.||||:|
  Rat   157 LHVYHHCTMFTLWWIGIKWVA----GGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRY 217

  Fly   191 ITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGK-KSAKQ 254
            :|:.|||||.:.:.|..::| ..:|...:.:.:...:.:..|..:|..||...|.:|.| |:.|.
  Rat   218 LTMLQLVQFHVTIGHTALSL-YTDCPFPKWMHWALIAYAISFIFLFLNFYTRTYNEPKKSKTGKT 281

  Fly   255 NKN 257
            ..|
  Rat   282 ATN 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 88/256 (34%)
Elovl4NP_001178725.1 ELO 41..278 CDD:395916 87/255 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.