DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and CG30008

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster


Alignment Length:278 Identity:82/278 - (29%)
Similarity:131/278 - (47%) Gaps:61/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 VKIPVV-SNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHF 71
            |.:|.: .:||..:..|:.||.||.|.||..||.|||:.|..:|.::|..|:             
  Fly    13 VNVPTIYKDPWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQV------------- 64

  Fly    72 LFVLKAYQISCIVSLP-----MDHK----YKDRE-----RLICTLYLVNKFV------DLVETIF 116
                    :|||.::.     .|:.    :|.|:     .|:...|.:..|:      :|:||:.
  Fly    65 --------VSCIYAIKEVLYITDNTIYIFWKCRDIGSSPELVRRYYNLAYFLFWLKISELIETVI 121

  Fly   117 FVLRKKDRQISFLHVFHHFAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKE- 180
            ||||||..|:|.||:||||:.....|....|:..|..|:....||:.||||||:||::::::.: 
  Fly   122 FVLRKKQNQVSKLHIFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKT 186

  Fly   181 -VQRSLWWKKYITIAQLVQFAIILLHCTITLAQPNCAVNRPLTYGCGS----LSAFFAVIFSQFY 240
             ||.....||.||:.|:.||.:||......|..            ||.    |..|..||...||
  Fly   187 LVQALTPVKKCITVIQMTQFVLILTQVAFQLVL------------CGMPPLVLLYFTTVILGMFY 239

  Fly   241 -YHNYIKPGKKSAKQNKN 257
             ::::.....:::::.|:
  Fly   240 GFYDFYNSAYQASQRRKS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 80/268 (30%)
CG30008NP_724853.1 ELO 20..257 CDD:279492 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449576
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
98.900

Return to query results.
Submit another query.