DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and elo-9

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_497086.1 Gene:elo-9 / 190207 WormBaseID:WBGene00001247 Length:286 Species:Caenorhabditis elegans


Alignment Length:256 Identity:61/256 - (23%)
Similarity:109/256 - (42%) Gaps:42/256 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 NPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKAYQ 79
            |.|.....|....:....|..:.||.|||..:..::..:|.|..:::    ::|. :.|.::.|.
 Worm    47 NHWFKSVYLSAAYIIATNLLQRYMESRKPKSMRPLLLAWNGFLAVFS----IMGT-WRFGIEFYD 106

  Fly    80 I---------SCIVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHF 135
            .         .|:...|     :........::.::|..:..:|:|.||||  |.:.|||.:||.
 Worm   107 AVFRRGFIDSICLAVNP-----RSPSAFWACMFALSKIAEFGDTMFLVLRK--RPVIFLHWYHHA 164

  Fly   136 AMAFFGYLYYCFHGYGGVAFPQ---CLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLV 197
            .:     |...:|....:..|.   ..:|..||.|||.||.::||...:.:.:  ...:|..|.:
 Worm   165 VV-----LILSWHAAIELTAPGRWFIFMNYLVHSIMYTYYAITSIGYRLPKIV--SMTVTFLQTL 222

  Fly   198 QFAI-ILLHCTITLAQPNCAV------NRPLTYGCGSLSAFFAVIFSQFYYHNY-IKPGKK 250
            |..| :.:.|.:...:.|..:      |..|::|   :.|.|.|:||.|:.:.| :|..||
 Worm   223 QMLIGVSISCIVLYLKLNGEMCQQSYDNLALSFG---IYASFLVLFSSFFNNAYLVKKDKK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 61/256 (24%)
elo-9NP_497086.1 ELO 44..274 CDD:279492 57/248 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.