DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and elo-7

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:256 Identity:66/256 - (25%)
Similarity:119/256 - (46%) Gaps:48/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 IGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKAYQI-------- 80
            |.|::.|..: .:.|..|:||.|...:|::|.|..:::    :.|...:|.....||        
 Worm    74 IAYVILVFSI-KRFMRDREPFQLTTALRLWNFFLSVFS----IYGSWTMFPFMVQQIRLYGLYGC 133

  Fly    81 --SCIVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGYL 143
              ..:.:||...:|      ...|.:::|.|:.|:|.|.|||||  .:.|||.:||.|.    ::
 Worm   134 GCEALSNLPSQAEY------WLFLTILSKAVEFVDTFFLVLRKK--PLIFLHWYHHMAT----FV 186

  Fly   144 YYCFHGYGGVAFPQ--------CLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFA 200
            ::|.:      :|.        .::|..||..||.||:..|::.:|...:  ...:|:.||.||.
 Worm   187 FFCSN------YPTPSSQSRVGVIVNLFVHAFMYPYYFTRSMNIKVPAKI--SMAVTVLQLTQFM 243

  Fly   201 IILLHCTI---TLA--QPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAKQNK 256
            ..:..||:   :||  |..|.....:.:...:||:.:.|:|:.|::..|::.|.|....|:
 Worm   244 CFIYGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSYFVLFANFFHKAYLQRGGKREHPNQ 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 65/250 (26%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.