DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl5

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:255 Identity:84/255 - (32%)
Similarity:125/255 - (49%) Gaps:56/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLKAYQISCIVSLPMDH 90
            |||.|. ||||.|::|:||...|::.:||:      ||.|         |..|....:|:...:.
  Rat    42 YLLIVW-LGPKYMKNRQPFSCRGILVVYNL------GLTL---------LSLYMFYELVTGVWEG 90

  Fly    91 KY-----------KDRERLICTL--YLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGY 142
            ||           :...::|..|  |..:|.::.::|.||:|||.:.||:.|||:||..|....:
  Rat    91 KYNFFCQGTRSAGESDMKVIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWW 155

  Fly   143 LYY----CFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIIL 203
            ...    |.|.|.|..     ||:.:||:||:||.|||: ..::..||||||||..|||||    
  Rat   156 FVMNWVPCGHSYFGAT-----LNSFIHVLMYSYYGLSSV-PSMRPYLWWKKYITQGQLVQF---- 210

  Fly   204 LHCTITLAQPNCAVNRPLTYGCGSLSAFFAV--------IFSQFYYHNYIKPGKKSAKQN 255
               .:|:.|.:|.|..|.::..|.|  :|.:        :|:.||...|.|.|....|::
  Rat   211 ---VLTIIQTSCGVIWPCSFPLGWL--YFQIGYMISLIALFTNFYIQTYNKKGASRRKEH 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 83/250 (33%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.