DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and Elovl6

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_569717.1 Gene:Elovl6 / 170439 MGIID:2156528 Length:267 Species:Mus musculus


Alignment Length:257 Identity:59/257 - (22%)
Similarity:104/257 - (40%) Gaps:60/257 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YLLFVLKLGPKIMEHRKPFHLNG-------VIRIYNIFQILYNGLILVLGVHFLFVLKAYQISCI 83
            |..|:.. |..:|..|..|.|..       .:.:::||..|..      |.:.|::|..      
Mouse    40 YAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRT------GAYMLYILMT------ 91

  Fly    84 VSLPMDHKYKDRERLICT--------------LYLVNKFVDLVETIFFVLRKKDRQISFLHVFHH 134
                     |..::.:|.              .::::|..:|.:|||.:|||  :::.|||.:||
Mouse    92 ---------KGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRK--QKLIFLHWYHH 145

  Fly   135 FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQF 199
            ..:..:.:..|.....||..|  ..:|..||.:||:||.|.:....|.|.  :..:||::|:.| 
Mouse   146 ITVLLYSWYSYKDMVAGGGWF--MTMNYGVHAVMYSYYALRAAGFRVSRK--FAMFITLSQITQ- 205

  Fly   200 AIILLHCTITLAQPN--------CAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKKSAK 253
              :|:.|.|.....|        |..:....:....:...:.|:|..|::..||...||:.|
Mouse   206 --MLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLVLFCHFFFEAYIGKVKKATK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 58/254 (23%)
Elovl6NP_569717.1 ELO 25..264 CDD:395916 58/254 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.710

Return to query results.
Submit another query.