DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eloF and elovl6l

DIOPT Version :9

Sequence 1:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:244 Identity:64/244 - (26%)
Similarity:108/244 - (44%) Gaps:36/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LIGYLLFVLKLGPK-IMEHRKPFHLNGVIRIYN----IFQILYNGLILVLGVHFLFVLKA---YQ 79
            |.|.:..||..|.: .|:.|:...|..|:.:::    ||.|:  |.:.. |...|::|..   .|
Zfish    37 LFGAVYVVLVFGGQHFMKDRQRLDLRKVLMMWSLSLAIFSII--GAVRT-GCFMLYILSTSGFKQ 98

  Fly    80 ISCIVSLPMDHKYKDRERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHHFAMAFFGYLY 144
            ..|..|.    .|....:.....::::|..:|.:|:|.||||  :::.|||.:||..:..:.:..
Zfish    99 SVCDQSF----YYGPISKFWACAFVLSKAPELGDTMFIVLRK--QRLIFLHWYHHITVLVYSWYS 157

  Fly   145 YCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQFAIILLHCTIT 209
            |.....||..|  ..:|..||.:||:||...:....|.:..  ...||.:|:.|.|:.|....:.
Zfish   158 YKDQVAGGGWF--MTMNYTVHALMYSYYAARAAGLRVPKPC--AILITSSQIAQMAMDLAVSALV 218

  Fly   210 ---LAQPNC------AVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGK 249
               :...:|      .|...|.|    ||  :.::||.|:|.:|:|..|
Zfish   219 YRWMQDGDCPSYLDNIVWASLMY----LS--YLLLFSSFFYQSYMKSSK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eloFNP_649956.1 ELO 11..252 CDD:279492 64/244 (26%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 64/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.