DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and ELO2

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_009963.1 Gene:ELO2 / 850400 SGDID:S000000630 Length:347 Species:Saccharomyces cerevisiae


Alignment Length:293 Identity:76/293 - (25%)
Similarity:133/293 - (45%) Gaps:64/293 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NGTLIISEDPV---RLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIM--- 64
            ||..:.||...   .|||...| |.|..::.|.:.:.. ||..:...||:.|..:.:.:|::   
Yeast    48 NGRFVPSEFQFIAGELPLSTLP-PVLYAITAYYVIIFG-GRFLLSKSKPFKLNGLFQLHNLVLTS 110

  Fly    65 -----------QIVYNGVILIAGLHFLFV-LKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFM 117
                       |:|  .:|:..||:|... :.|:....:|              |.|..:..||:
Yeast   111 LSLTLLLLMVEQLV--PIIVQHGLYFAICNIGAWTQPLVT--------------LYYMNYIVKFI 159

  Fly   118 DLLETVFFVLRKKDRQISFLHVFHHLVMSFGGYLHITFNGYGGTL----FPLCLLNVAVHVIMYA 178
            :.::|.|.||  |.::::|||.:||     |....:.:....||.    .|:. ||:.|||:||.
Yeast   160 EFIDTFFLVL--KHKKLTFLHTYHH-----GATALLCYTQLMGTTSISWVPIS-LNLGVHVVMYW 216

  Fly   179 YYYLSSVSKDVQTSRWKKYITIVQLVQFILVLANFSYTLMQP-------------DCNASRTVIY 230
            ||:|::....|.   ||:::|..|::||:|.:....:.:.|.             ||..|.|..:
Yeast   217 YYFLAARGIRVW---WKEWVTRFQIIQFVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATF 278

  Fly   231 TGMFISTTFILMFANFYIHNYILNGSKQKSALK 263
            .|..|.::::::|.:|||:.|...|:|....:|
Yeast   279 AGCAIISSYLVLFISFYINVYKRKGTKTSRVVK 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 70/271 (26%)
ELO2NP_009963.1 ELO 64..307 CDD:395916 70/271 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.